Lineage for d1bmld3 (1bml D:285-372)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 599020Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family) (S)
  5. 599021Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins)
  6. 599034Protein Streptokinase [54332] (1 species)
    duplication: consists of three similar domains
  7. 599035Species Streptococcus equisimilis [TaxId:119602] [54333] (5 PDB entries)
  8. 599051Domain d1bmld3: 1bml D:285-372 [37734]
    Other proteins in same PDB: d1bmla_, d1bmlb_
    mutant

Details for d1bmld3

PDB Entry: 1bml (more details), 2.9 Å

PDB Description: complex of the catalytic domain of human plasmin and streptokinase

SCOP Domain Sequences for d1bmld3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmld3 d.15.5.1 (D:285-372) Streptokinase {Streptococcus equisimilis}
dpfdrshlklftikyvdvntnellkseqlltasernldfrdlydprdkakllynnldafg
imdytltgkvednhddtnriitvymgkr

SCOP Domain Coordinates for d1bmld3:

Click to download the PDB-style file with coordinates for d1bmld3.
(The format of our PDB-style files is described here.)

Timeline for d1bmld3: