SCOP 1.71: Domain d1bmlb_: 1bml B:

Lineage for d1bmlb_ (1bml B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Plasmin(ogen), catalytic domain [50588] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50589] (7 PDB entries)

8. Domain d1bmlb_: 1bml B: [26373]
   Other proteins in same PDB: d1bmlc1, d1bmlc2, d1bmlc3, d1bmld1, d1bmld2, d1bmld3
   mutant

Details for d1bmlb_

PDB Entry: 1bml, 2.9 Å

PDB Description: complex of the catalytic domain of human plasmin and streptokinase

SCOP Domain Sequences for d1bmlb_:

Sequence; same for both SEQRES and ATOM records:

>d1bmlb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens)}
aapsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvlta
ahcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdk
vipaclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvq
stelcaghlaggtdscqgdaggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfv
twiegvmrnn

Timeline for d1bmlb_:

• d1bmlb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bmlb_ appears in SCOP 1.69
  
• d1bmlb_ appears in SCOP 1.73
  
• d1bmlb_ appears in the current release, SCOPe 2.08