Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family) |
Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins) |
Protein Streptokinase [54332] (1 species) duplication: consists of three similar domains |
Species Streptococcus equisimilis [TaxId:119602] [54333] (5 PDB entries) |
Domain d1bmld3: 1bml D:285-372 [37734] Other proteins in same PDB: d1bmla_, d1bmlb_ mutant |
PDB Entry: 1bml (more details), 2.9 Å
SCOP Domain Sequences for d1bmld3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bmld3 d.15.5.1 (D:285-372) Streptokinase {Streptococcus equisimilis [TaxId: 119602]} dpfdrshlklftikyvdvntnellkseqlltasernldfrdlydprdkakllynnldafg imdytltgkvednhddtnriitvymgkr
Timeline for d1bmld3: