Lineage for d1c4pa_ (1c4p A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family) 
Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins) 
Protein Streptokinase [54332] (1 species) Species Streptococcus equisimilis [TaxId:119602] [54333] (3 PDB entries) 
Domain d1c4pa_: 1c4p A: [37725]
Details for d1c4pa_
PDB Entry: 1c4p (more details), 2.4 Å
PDB Description: beta domain of streptokinase
SCOP Domain Sequences for d1c4pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c4pa_ d.15.5.1 (A:) Streptokinase {Streptococcus equisimilis}
kpiqnqaksvdveytvqftplnpdddfrpglkdtkllktlaigdtitsqellaqaqsiln
kthpgytiyerdssivthdndifrtilpmdqeftyhvknreqayeinkksglneeinntd
lisekyyvlkkgekpyd
SCOP Domain Coordinates for d1c4pa_:
Click to download the PDB-style file with coordinates for d1c4pa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c4pa_:
- d1c4pa_ appears in SCOP 1.57
- d1c4pa_ appears in the current release, SCOPe 2.08
View in 3D
