Lineage for d6hgoc_ (6hgo C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033912Family g.17.1.6: Interleukin 17F, IL-17F [69955] (2 proteins)
  6. 3033919Protein automated matches [338587] (1 species)
    not a true protein
  7. 3033920Species Human (Homo sapiens) [TaxId:9606] [338588] (3 PDB entries)
  8. 3033923Domain d6hgoc_: 6hgo C: [376995]
    automated match to d1jpyy_
    complexed with nag, so4

Details for d6hgoc_

PDB Entry: 6hgo (more details), 2.1 Å

PDB Description: crystal structure of human il-17f
PDB Compounds: (C:) Interleukin-17F

SCOPe Domain Sequences for d6hgoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hgoc_ g.17.1.6 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkvghtffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwnytvtwdpnry
psevvqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqlekvlvtvgct
cvtpvih

SCOPe Domain Coordinates for d6hgoc_:

Click to download the PDB-style file with coordinates for d6hgoc_.
(The format of our PDB-style files is described here.)

Timeline for d6hgoc_: