Lineage for d1jpyy_ (1jpy Y:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. Family g.17.1.6: Interleukin 17F, IL-17F [69955] (2 proteins)
  6. Protein Interleukin 17F, IL-17F [69956] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [69957] (1 PDB entry)
  8. Domain d1jpyy_: 1jpy Y: [67068]
    complexed with nag, so4

Details for d1jpyy_

PDB Entry: 1jpy (more details), 2.8499999999999996 Å

PDB Description: crystal structure of il-17f
PDB Compounds: (Y:) interleukin 17F

SCOPe Domain Sequences for d1jpyy_:

Sequence, based on SEQRES records: (download)

>d1jpyy_ g.17.1.6 (Y:) Interleukin 17F, IL-17F {Human (Homo sapiens) [TaxId: 9606]}
vghtffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwnytvtwdpnryps
evvqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqlekvlvtvgctcv
tpvih

Sequence, based on observed residues (ATOM records): (download)

>d1jpyy_ g.17.1.6 (Y:) Interleukin 17F, IL-17F {Human (Homo sapiens) [TaxId: 9606]}
vghtffqkpescpsmkldigiinenqrvsmsrniesrstspwnytvtwdpnrypsevvqa
qcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqlekvlvtvgctcvtpvih

SCOPe Domain Coordinates for d1jpyy_ are not available.

Timeline for d1jpyy_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jpya_, d1jpyb_, d1jpyx_