PDB entry 6hgo

View 6hgo on RCSB PDB site
Description: Crystal Structure of human IL-17F
Class: immune system
Keywords: cystine-knot, cytokine, IMMUNE SYSTEM
Deposited on 2018-08-23, released 2019-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-17F
    Species: Homo sapiens [TaxId:9606]
    Gene: IL17F
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hgoa_
  • Chain 'B':
    Compound: Interleukin-17F
    Species: Homo sapiens [TaxId:9606]
    Gene: IL17F
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hgob_
  • Chain 'C':
    Compound: Interleukin-17F
    Species: Homo sapiens [TaxId:9606]
    Gene: IL17F
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hgoc_
  • Chain 'D':
    Compound: Interleukin-17F
    Species: Homo sapiens [TaxId:9606]
    Gene: IL17F
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hgod_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hgoA (A:)
    efrhdsrkipkvghtffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwny
    tvtwdpnrypsevvqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqle
    kvlvtvgctcvtpvihhvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hgoA (A:)
    htffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwnytvtwdpnrypsev
    vqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqlekvlvtvgctcvtp
    vihhvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hgoB (B:)
    efrhdsrkipkvghtffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwny
    tvtwdpnrypsevvqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqle
    kvlvtvgctcvtpvihhvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hgoB (B:)
    ghtffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwnytvtwdpnrypse
    vvqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqlekvlvtvgctcvt
    pv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hgoC (C:)
    efrhdsrkipkvghtffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwny
    tvtwdpnrypsevvqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqle
    kvlvtvgctcvtpvihhvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hgoC (C:)
    pkvghtffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwnytvtwdpnry
    psevvqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqlekvlvtvgct
    cvtpvih
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hgoD (D:)
    efrhdsrkipkvghtffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwny
    tvtwdpnrypsevvqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqle
    kvlvtvgctcvtpvihhvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hgoD (D:)
    htffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwnytvtwdpnrypsev
    vqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqlekvlvtvgctcvtp
    v