| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
| Protein automated matches [190805] (18 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188286] (68 PDB entries) |
| Domain d6u7ea2: 6u7e A:288-548 [376908] Other proteins in same PDB: d6u7ea1, d6u7ea3, d6u7ea4, d6u7eb1, d6u7eb3, d6u7eb4 automated match to d4fyta2 complexed with bma, nag, zn |
PDB Entry: 6u7e (more details), 3 Å
SCOPe Domain Sequences for d6u7ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u7ea2 d.92.1.0 (A:288-548) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyvekqasngvliriwarpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglp
dfnagamenwglvtyrensllfdplsssssnkervvtviahelahqwfgnlvtiewwndl
wlnegfasyveylgadyaeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaq
iselfdaisyskgasvlrmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnn
rsiqlpttvrdimnrwtlqmg
Timeline for d6u7ea2:
View in 3DDomains from other chains: (mouse over for more information) d6u7eb1, d6u7eb2, d6u7eb3, d6u7eb4 |