Lineage for d6u7ea2 (6u7e A:288-548)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2571488Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2571489Protein automated matches [190805] (18 species)
    not a true protein
  7. 2571522Species Human (Homo sapiens) [TaxId:9606] [188286] (68 PDB entries)
  8. 2571647Domain d6u7ea2: 6u7e A:288-548 [376908]
    Other proteins in same PDB: d6u7ea1, d6u7ea3, d6u7ea4, d6u7eb1, d6u7eb3, d6u7eb4
    automated match to d4fyta2
    complexed with bma, nag, zn

Details for d6u7ea2

PDB Entry: 6u7e (more details), 3 Å

PDB Description: hcov-229e rbd class iii in complex with human apn
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d6u7ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u7ea2 d.92.1.0 (A:288-548) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyvekqasngvliriwarpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglp
dfnagamenwglvtyrensllfdplsssssnkervvtviahelahqwfgnlvtiewwndl
wlnegfasyveylgadyaeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaq
iselfdaisyskgasvlrmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnn
rsiqlpttvrdimnrwtlqmg

SCOPe Domain Coordinates for d6u7ea2:

Click to download the PDB-style file with coordinates for d6u7ea2.
(The format of our PDB-style files is described here.)

Timeline for d6u7ea2: