Lineage for d1he8a3 (1he8 A:144-321)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1638364Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 1638384Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)
    includes parts of the flanking linkers
  7. 1638385Species Human (Homo sapiens) [TaxId:9606] [54276] (57 PDB entries)
  8. 1638424Domain d1he8a3: 1he8 A:144-321 [37637]
    Other proteins in same PDB: d1he8a1, d1he8a2, d1he8a4, d1he8b_
    complexed with gnp, mg

Details for d1he8a3

PDB Entry: 1he8 (more details), 3 Å

PDB Description: ras g12v - pi 3-kinase gamma complex
PDB Compounds: (A:) phosphatidylinositol 3-kinase catalytic subunit, gamma isoform

SCOPe Domain Sequences for d1he8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1he8a3 d.15.1.5 (A:144-321) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifikihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

SCOPe Domain Coordinates for d1he8a3:

Click to download the PDB-style file with coordinates for d1he8a3.
(The format of our PDB-style files is described here.)

Timeline for d1he8a3: