Lineage for d1he8a3 (1he8 A:144-321)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30384Superfamily d.15.1: Ubiquitin-like [54236] (5 families) (S)
  5. 30445Family d.15.1.5: Ras-binding domain, RBD [54263] (5 proteins)
  6. 30453Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)
  7. 30454Species Human (Homo sapiens) [TaxId:9606] [54276] (3 PDB entries)
  8. 30457Domain d1he8a3: 1he8 A:144-321 [37637]
    Other proteins in same PDB: d1he8a1, d1he8a2, d1he8a4, d1he8b_

Details for d1he8a3

PDB Entry: 1he8 (more details), 3 Å

PDB Description: ras g12v - pi 3-kinase gamma complex
PDB Compounds: (A:)

SCOP Domain Sequences for d1he8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1he8a3 d.15.1.5 (A:144-321) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens)}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifikihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

SCOP Domain Coordinates for d1he8a3:

Click to download the PDB-style file with coordinates for d1he8a3.
(The format of our PDB-style files is described here.)

Timeline for d1he8a3: