Lineage for d1he8b_ (1he8 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1594521Protein cH-p21 Ras protein [52593] (1 species)
  7. 1594522Species Human (Homo sapiens) [TaxId:9606] [52594] (104 PDB entries)
    Uniprot Q6P716
  8. 1594629Domain d1he8b_: 1he8 B: [31995]
    Other proteins in same PDB: d1he8a1, d1he8a2, d1he8a3, d1he8a4
    complexed with gnp, mg

Details for d1he8b_

PDB Entry: 1he8 (more details), 3 Å

PDB Description: ras g12v - pi 3-kinase gamma complex
PDB Compounds: (B:) transforming protein p21/h-ras-1

SCOPe Domain Sequences for d1he8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1he8b_ c.37.1.8 (B:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d1he8b_:

Click to download the PDB-style file with coordinates for d1he8b_.
(The format of our PDB-style files is described here.)

Timeline for d1he8b_: