Lineage for d1he8b_ (1he8 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23153Protein cH-p21 Ras protein [52593] (1 species)
  7. 23154Species Human (Homo sapiens) [TaxId:9606] [52594] (33 PDB entries)
  8. 23185Domain d1he8b_: 1he8 B: [31995]
    Other proteins in same PDB: d1he8a1, d1he8a2, d1he8a3, d1he8a4

Details for d1he8b_

PDB Entry: 1he8 (more details), 3 Å

PDB Description: ras g12v - pi 3-kinase gamma complex
PDB Compounds: (B:)

SCOP Domain Sequences for d1he8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1he8b_ c.37.1.8 (B:) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOP Domain Coordinates for d1he8b_:

Click to download the PDB-style file with coordinates for d1he8b_.
(The format of our PDB-style files is described here.)

Timeline for d1he8b_: