SCOPe 2.08: Domain d6j14g_: 6j14 G:

Lineage for d6j14g_ (6j14 G:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [256383] (17 PDB entries)

8. Domain d6j14g_: 6j14 G: [376355]
   Other proteins in same PDB: d6j14a1, d6j14a2, d6j14b_
   automated match to d3rrqa_

Details for d6j14g_

PDB Entry: 6j14, 1.4 Å

PDB Description: complex structure of gy-14 and pd-1

PDB Compounds: (G:) Programmed cell death protein 1

SCOPe Domain Sequences for d6j14g_:

Sequence, based on SEQRES records:

>d6j14g_ b.1.1.1 (G:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
npptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqd
crfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvter

Sequence, based on observed residues (ATOM records):

>d6j14g_ b.1.1.1 (G:) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
npptfspallvvtegdnatftcsfvlnwyrmspsnqtdklaafpdcrfrvtqlpngrdfh
msvvrarrndsgtylcgaislapkaqikeslraelrvter

Timeline for d6j14g_:

• d6j14g_ first appeared in SCOPe 2.07