SCOPe 2.08: Domain d6j14a1: 6j14 A:9-119

Lineage for d6j14a1 (6j14 A:9-119)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d6j14a1: 6j14 A:9-119 [376353]
   Other proteins in same PDB: d6j14a2, d6j14g_
   automated match to d1a6wh_

Details for d6j14a1

PDB Entry: 6j14, 1.4 Å

PDB Description: complex structure of gy-14 and pd-1

PDB Compounds: (A:) GY-14 heavy chain V fragment

SCOPe Domain Sequences for d6j14a1:

Sequence, based on SEQRES records:

>d6j14a1 b.1.1.1 (A:9-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aelvrpgasvklsckalgdtftdyeihwvkqtpvhglewigvihpgsggtvynqkfkgka
tltadkysstaymelssltsedsavyyctregmntdwyfdvwgagttvtvs

Sequence, based on observed residues (ATOM records):

>d6j14a1 b.1.1.1 (A:9-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aelvrpgasvklsckalgdyeihwvkqtpvhglewigvihpgsggtvynqkfkgkatlta
dkysstaymelssltsedsavyyctregmntdwyfdvwgagttvtvs

Timeline for d6j14a1:

• d6j14a1 first appeared in SCOPe 2.07