| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
| Protein automated matches [190205] (33 species) not a true protein |
| Species Streptomyces antibioticus [TaxId:1890] [376339] (1 PDB entry) |
| Domain d6hnna_: 6hnn A: [376344] automated match to d1sjwa_ |
PDB Entry: 6hnn (more details), 2.7 Å
SCOPe Domain Sequences for d6hnna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hnna_ d.17.4.0 (A:) automated matches {Streptomyces antibioticus [TaxId: 1890]}
hqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqf
tqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsrvrdgr
ivehwtisdnvtmlaqlgvka
Timeline for d6hnna_: