Lineage for d6hnng_ (6hnn G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2544255Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2544256Protein automated matches [190205] (33 species)
    not a true protein
  7. 2544398Species Streptomyces antibioticus [TaxId:1890] [376339] (1 PDB entry)
  8. 2544405Domain d6hnng_: 6hnn G: [376342]
    automated match to d1sjwa_

Details for d6hnng_

PDB Entry: 6hnn (more details), 2.7 Å

PDB Description: crystal structure of wild-type idmh, a putative polyketide cyclase from streptomyces antibioticus
PDB Compounds: (G:) Putative polyketide cyclase IdmH

SCOPe Domain Sequences for d6hnng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hnng_ d.17.4.0 (G:) automated matches {Streptomyces antibioticus [TaxId: 1890]}
qpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqft
qaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsrvrdgri
vehwtisdnvtmlaqlgv

SCOPe Domain Coordinates for d6hnng_:

Click to download the PDB-style file with coordinates for d6hnng_.
(The format of our PDB-style files is described here.)

Timeline for d6hnng_: