Lineage for d6k01d_ (6k01 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698177Protein Histone H2B [47119] (6 species)
  7. 2698178Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (42 PDB entries)
  8. 2698252Domain d6k01d_: 6k01 D: [375732]
    Other proteins in same PDB: d6k01c_
    automated match to d1aoid_

Details for d6k01d_

PDB Entry: 6k01 (more details), 2.84 Å

PDB Description: crystal structure of xh2a-h2b
PDB Compounds: (D:) Histone H2B 1.1

SCOPe Domain Sequences for d6k01d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k01d_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtky

SCOPe Domain Coordinates for d6k01d_:

Click to download the PDB-style file with coordinates for d6k01d_.
(The format of our PDB-style files is described here.)

Timeline for d6k01d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6k01c_