Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2B [47119] (6 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (42 PDB entries) |
Domain d6k01d_: 6k01 D: [375732] Other proteins in same PDB: d6k01c_ automated match to d1aoid_ |
PDB Entry: 6k01 (more details), 2.84 Å
SCOPe Domain Sequences for d6k01d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k01d_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]} rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr eiqtavrlllpgelakhavsegtkavtky
Timeline for d6k01d_: