Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein automated matches [190304] (16 species) not a true protein |
Species Escherichia coli [TaxId:83333] [356353] (9 PDB entries) |
Domain d6n5ib2: 6n5i B:285-495 [375722] Other proteins in same PDB: d6n5ia1, d6n5ia3, d6n5ib1, d6n5ib3 automated match to d2qy9a2 complexed with gol, k |
PDB Entry: 6n5i (more details), 1.5 Å
SCOPe Domain Sequences for d6n5ib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n5ib2 c.37.1.10 (B:285-495) automated matches {Escherichia coli [TaxId: 83333]} plnvegkapfvilmvgvngvgktttigklarqfeqqgksvmlaagdtfraaaveqlqvwg qrnnipviaqhtgadsasvifdaiqaakarnidvliadtagrlqnkshlmeelkkivrvm kkldveaphevmltidastgqnavsqaklfheavgltgitltkldgtakggvifsvadqf gipiryigvgeriedlrpfkaddfiealfar
Timeline for d6n5ib2: