Lineage for d6jh1c1 (6jh1 C:3-78)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540258Species Bos taurus [TaxId:9913] [375619] (1 PDB entry)
  8. 2540259Domain d6jh1c1: 6jh1 C:3-78 [375620]
    Other proteins in same PDB: d6jh1a_, d6jh1b_
    automated match to d3pseb1

Details for d6jh1c1

PDB Entry: 6jh1 (more details), 3 Å

PDB Description: crystal structure of bisg15/ns1b complex
PDB Compounds: (C:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d6jh1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jh1c1 d.15.1.0 (C:3-78) automated matches {Bos taurus [TaxId: 9913]}
gdltvkmlggqeilvplrdsmtvselkqfiaqkinvpafqqrlahldsrevlqegvplvl
qglragstvllvvqns

SCOPe Domain Coordinates for d6jh1c1:

Click to download the PDB-style file with coordinates for d6jh1c1.
(The format of our PDB-style files is described here.)

Timeline for d6jh1c1:

2540259
d6jh1c1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6jh1c2