PDB entry 6jh1

View 6jh1 on RCSB PDB site
Description: Crystal structure of bISG15/NS1B complex
Class: antiviral protein
Keywords: Complex, Antivral, ANTIVIRAL PROTEIN
Deposited on 2019-02-16, released 2019-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural protein 1
    Species: Influenza B virus (strain B/Lee/1940) [TaxId:518987]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jh1a_
  • Chain 'B':
    Compound: Non-structural protein 1
    Species: Influenza B virus (strain B/Lee/1940) [TaxId:518987]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jh1b_
  • Chain 'C':
    Compound: Ubiquitin-like protein ISG15
    Species: Bos taurus [TaxId:9913]
    Gene: ISG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02741
      • engineered mutation (77)
    Domains in SCOPe 2.07: d6jh1c1, d6jh1c2
  • Chain 'D':
    Compound: Ubiquitin-like protein ISG15
    Species: Bos taurus [TaxId:9913]
    Gene: ISG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02741
      • engineered mutation (77)
    Domains in SCOPe 2.07: d6jh1d1, d6jh1d2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jh1A (A:)
    madnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrik
    thnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jh1A (A:)
    qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe
    nkrmsleerkaigvkmmkvllfmdpsagiegf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jh1B (B:)
    madnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrik
    thnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jh1B (B:)
    qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe
    nkrmsleerkaigvkmmkvllfmdpsagieg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6jh1C (C:)
    mggdltvkmlggqeilvplrdsmtvselkqfiaqkinvpafqqrlahldsrevlqegvpl
    vlqglragstvllvvqnsisilvrndkgrsspyevqlkqtvaelkqqvcqkervqadqfw
    lsfegrpmddehpleeyglmkgctvfmnlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jh1C (C:)
    gdltvkmlggqeilvplrdsmtvselkqfiaqkinvpafqqrlahldsrevlqegvplvl
    qglragstvllvvqnsisilvrndkgrsspyevqlkqtvaelkqqvcqkervqadqfwls
    fegrpmddehpleeyglmkgctvfmnl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6jh1D (D:)
    mggdltvkmlggqeilvplrdsmtvselkqfiaqkinvpafqqrlahldsrevlqegvpl
    vlqglragstvllvvqnsisilvrndkgrsspyevqlkqtvaelkqqvcqkervqadqfw
    lsfegrpmddehpleeyglmkgctvfmnlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jh1D (D:)
    gdltvkmlggqeilvplrdsmtvselkqfiaqkinvpafqqrlahldsrevlqegvplvl
    qglragstvllvvqnsisilvrndkgrsspyevqlkqtvaelkqqvcqkervqadqfwls
    fegrpmddehpleeyglmkgctvfmnl