Lineage for d6jh1b_ (6jh1 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311085Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2311086Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2311087Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 2311100Protein automated matches [190929] (8 species)
    not a true protein
  7. 2311133Species Influenza b virus (strain b/lee/1940) [TaxId:518987] [375508] (1 PDB entry)
  8. 2311135Domain d6jh1b_: 6jh1 B: [375509]
    Other proteins in same PDB: d6jh1c1, d6jh1c2, d6jh1d1, d6jh1d2
    automated match to d3sdlb_

Details for d6jh1b_

PDB Entry: 6jh1 (more details), 3 Å

PDB Description: crystal structure of bisg15/ns1b complex
PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d6jh1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jh1b_ a.16.1.1 (B:) automated matches {Influenza b virus (strain b/lee/1940) [TaxId: 518987]}
qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe
nkrmsleerkaigvkmmkvllfmdpsagieg

SCOPe Domain Coordinates for d6jh1b_:

Click to download the PDB-style file with coordinates for d6jh1b_.
(The format of our PDB-style files is described here.)

Timeline for d6jh1b_: