Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (2 families) |
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins) topologically similar to the N-terminal domain of protein kinases |
Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries) |
Domain d1av5b_: 1av5 B: [37515] complexed with ap2 |
PDB Entry: 1av5 (more details), 2 Å
SCOP Domain Sequences for d1av5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1av5b_ d.13.1.1 (B:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)} ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
Timeline for d1av5b_: