SCOP 1.63: Domain d1av5b_: 1av5 B:

Lineage for d1av5b_ (1av5 B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (2 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins)
   topologically similar to the N-terminal domain of protein kinases

6. Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries)

8. Domain d1av5b_: 1av5 B: [37515]
   complexed with ap2

Details for d1av5b_

PDB Entry: 1av5, 2 Å

PDB Description: pkci-substrate analog

SCOP Domain Sequences for d1av5b_:

Sequence; same for both SEQRES and ATOM records:

>d1av5b_ d.13.1.1 (B:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)}
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

Timeline for d1av5b_:

• d1av5b_ first appeared (with stable ids) in SCOP 1.55
  
• d1av5b_ appears in SCOP 1.61
  
• d1av5b_ appears in SCOP 1.65
  
• d1av5b_ appears in the current release, SCOPe 2.08