Lineage for d1av5b_ (1av5 B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189040Fold d.13: HIT-like [54196] (2 superfamilies)
  4. 189041Superfamily d.13.1: HIT-like [54197] (2 families) (S)
  5. 189042Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins)
  6. 189063Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species)
  7. 189064Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries)
  8. 189073Domain d1av5b_: 1av5 B: [37515]

Details for d1av5b_

PDB Entry: 1av5 (more details), 2 Å

PDB Description: pkci-substrate analog

SCOP Domain Sequences for d1av5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1av5b_ d.13.1.1 (B:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)}
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOP Domain Coordinates for d1av5b_:

Click to download the PDB-style file with coordinates for d1av5b_.
(The format of our PDB-style files is described here.)

Timeline for d1av5b_: