PDB entry 1av5

View 1av5 on RCSB PDB site
Description: pkci-substrate analog
Deposited on 1997-09-25, released 1998-03-25
The last revision prior to the SCOP 1.61 freeze date was dated 1998-03-25, with a file datestamp of 1998-03-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1av5a_
  • Chain 'B':
    Domains in SCOP 1.61: d1av5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1av5A (A:)
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1av5B (B:)
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg