Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.10: DNA-binding domain [54170] (1 superfamily) beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.10.1: DNA-binding domain [54171] (5 families) |
Family d.10.1.3: Methyl-CpG-binding domain, MBD [54178] (2 proteins) |
Protein Methylation-dependent transcriptional repressor MBD1/PCM1 [54181] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54182] (2 PDB entries) |
Domain d1d9na_: 1d9n A: [37486] |
PDB Entry: 1d9n (more details)
SCOPe Domain Sequences for d1d9na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d9na_ d.10.1.3 (A:) Methylation-dependent transcriptional repressor MBD1/PCM1 {Human (Homo sapiens) [TaxId: 9606]} maedwldcpalgpgwkrrevfrksgatcgrsdtyyqsptgdrirskveltrylgpacdlt lfdfkqgilcypapk
Timeline for d1d9na_: