SCOPe 2.08: Domain d1d9na_: 1d9n A:

Lineage for d1d9na_ (1d9n A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.10: DNA-binding domain [54170] (1 superfamily)
   beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.10.1: DNA-binding domain [54171] (5 families)

5. Family d.10.1.3: Methyl-CpG-binding domain, MBD [54178] (2 proteins)

6. Protein Methylation-dependent transcriptional repressor MBD1/PCM1 [54181] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54182] (2 PDB entries)

8. Domain d1d9na_: 1d9n A: [37486]

Details for d1d9na_

PDB Entry: 1d9n

PDB Description: solution structure of the methyl-cpg-binding domain of the methylation-dependent transcriptional repressor mbd1/pcm1

PDB Compounds: (A:) methyl-cpg-binding protein mbd1

SCOPe Domain Sequences for d1d9na_:

Sequence; same for both SEQRES and ATOM records:

>d1d9na_ d.10.1.3 (A:) Methylation-dependent transcriptional repressor MBD1/PCM1 {Human (Homo sapiens) [TaxId: 9606]}
maedwldcpalgpgwkrrevfrksgatcgrsdtyyqsptgdrirskveltrylgpacdlt
lfdfkqgilcypapk

Timeline for d1d9na_:

• d1d9na_ first appeared (with stable ids) in SCOP 1.55
  
• d1d9na_ appears in SCOPe 2.07