PDB entry 1d9n

View 1d9n on RCSB PDB site
Description: solution structure of the methyl-cpg-binding domain of the methylation-dependent transcriptional repressor mbd1/pcm1
Class: gene regulation
Keywords: mbd, methyl-cpg, pcm1, methylation, DNA binding domain, gene regulation
Deposited on 1999-10-28, released 2000-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-cpg-binding protein mbd1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1d9na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9nA (A:)
    maedwldcpalgpgwkrrevfrksgatcgrsdtyyqsptgdrirskveltrylgpacdlt
    lfdfkqgilcypapk