Lineage for d1d9na_ (1d9n A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636162Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 1636163Superfamily d.10.1: DNA-binding domain [54171] (5 families) (S)
  5. 1636177Family d.10.1.3: Methyl-CpG-binding domain, MBD [54178] (2 proteins)
  6. 1636183Protein Methylation-dependent transcriptional repressor MBD1/PCM1 [54181] (1 species)
  7. 1636184Species Human (Homo sapiens) [TaxId:9606] [54182] (2 PDB entries)
  8. 1636186Domain d1d9na_: 1d9n A: [37486]

Details for d1d9na_

PDB Entry: 1d9n (more details)

PDB Description: solution structure of the methyl-cpg-binding domain of the methylation-dependent transcriptional repressor mbd1/pcm1
PDB Compounds: (A:) methyl-cpg-binding protein mbd1

SCOPe Domain Sequences for d1d9na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9na_ d.10.1.3 (A:) Methylation-dependent transcriptional repressor MBD1/PCM1 {Human (Homo sapiens) [TaxId: 9606]}
maedwldcpalgpgwkrrevfrksgatcgrsdtyyqsptgdrirskveltrylgpacdlt
lfdfkqgilcypapk

SCOPe Domain Coordinates for d1d9na_:

Click to download the PDB-style file with coordinates for d1d9na_.
(The format of our PDB-style files is described here.)

Timeline for d1d9na_: