SCOPe 2.08: Domain d1e0ba_: 1e0b A:

Lineage for d1e0ba_ (1e0b A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein Heterochromatin protein 1, HP1 [54166] (4 species)
   duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain

7. Species Fission yeast (Schizosaccharomyces pombe), SWI6 [TaxId:4896] [54169] (1 PDB entry)

8. Domain d1e0ba_: 1e0b A: [37476]
   C-terminal shadow chromo domain
   complexed with 1pg

Details for d1e0ba_

PDB Entry: 1e0b, 1.9 Å

PDB Description: chromo shadow domain from fission yeast swi6 protein.

PDB Compounds: (A:) swi6 protein

SCOPe Domain Sequences for d1e0ba_:

Sequence; same for both SEQRES and ATOM records:

>d1e0ba_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fission yeast (Schizosaccharomyces pombe), SWI6 [TaxId: 4896]}
qvenydswedlvssidtierkddgtleiyltwkngaishhpstitnkkcpqkmlqfyesh
l

Timeline for d1e0ba_:

• d1e0ba_ first appeared (with stable ids) in SCOP 1.55
  
• d1e0ba_ appears in SCOPe 2.07