Lineage for d1e0ba_ (1e0b A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394630Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2394676Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2394721Protein Heterochromatin protein 1, HP1 [54166] (4 species)
    duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
  7. 2394722Species Fission yeast (Schizosaccharomyces pombe), SWI6 [TaxId:4896] [54169] (1 PDB entry)
  8. 2394723Domain d1e0ba_: 1e0b A: [37476]
    C-terminal shadow chromo domain
    complexed with 1pg

Details for d1e0ba_

PDB Entry: 1e0b (more details), 1.9 Å

PDB Description: chromo shadow domain from fission yeast swi6 protein.
PDB Compounds: (A:) swi6 protein

SCOPe Domain Sequences for d1e0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0ba_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fission yeast (Schizosaccharomyces pombe), SWI6 [TaxId: 4896]}
qvenydswedlvssidtierkddgtleiyltwkngaishhpstitnkkcpqkmlqfyesh
l

SCOPe Domain Coordinates for d1e0ba_:

Click to download the PDB-style file with coordinates for d1e0ba_.
(The format of our PDB-style files is described here.)

Timeline for d1e0ba_: