![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
![]() | Protein automated matches [190967] (35 species) not a true protein |
![]() | Species Vibrio fischeri [TaxId:312309] [330859] (2 PDB entries) |
![]() | Domain d6pxad_: 6pxa D: [374755] Other proteins in same PDB: d6pxaa2, d6pxab2, d6pxac2, d6pxae2, d6pxag2, d6pxai2, d6pxaj2, d6pxak2 automated match to d5ux9d_ complexed with act, cl, fmt, gol, so4, tch |
PDB Entry: 6pxa (more details), 1.82 Å
SCOPe Domain Sequences for d6pxad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pxad_ b.81.1.0 (D:) automated matches {Vibrio fischeri [TaxId: 312309]} afnswlegqnlkeqvknpnievgdysyysgfyhsktfeeqavryllgdaptqevwesgqf gevdklrigkfcsiasgatfmmagnqghradwistfpfskkefgegvkdgfqragdtivg ndvwigseamimpgvhigdgaiigaravitknvapysvvvgnnvvvkkrfdenliqtllv ikwwdwplqhikntmeilcsghieeleqyfiknvg
Timeline for d6pxad_: