Lineage for d6pxab1 (6pxa B:1-217)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423278Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2423279Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2423626Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2423627Protein automated matches [190967] (35 species)
    not a true protein
  7. 2423865Species Vibrio fischeri [TaxId:312309] [330859] (2 PDB entries)
  8. 2423867Domain d6pxab1: 6pxa B:1-217 [374700]
    Other proteins in same PDB: d6pxaa2, d6pxab2, d6pxac2, d6pxae2, d6pxag2, d6pxai2, d6pxaj2, d6pxak2
    automated match to d5ux9d_
    complexed with act, cl, fmt, gol, so4, tch

Details for d6pxab1

PDB Entry: 6pxa (more details), 1.82 Å

PDB Description: the crystal structure of chloramphenicol acetyltransferase-like protein from vibrio fischeri es114 in complex with taurocholic acid
PDB Compounds: (B:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d6pxab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pxab1 b.81.1.0 (B:1-217) automated matches {Vibrio fischeri [TaxId: 312309]}
meafnswlegqnlkeqvknpnievgdysyysgfyhsktfeeqavryllgdaptqevwesg
qfgevdklrigkfcsiasgatfmmagnqghradwistfpfskkefgegvkdgfqragdti
vgndvwigseamimpgvhigdgaiigaravitknvapysvvvgnnvvvkkrfdenliqtl
lvikwwdwplqhikntmeilcsghieeleqyfiknvg

SCOPe Domain Coordinates for d6pxab1:

Click to download the PDB-style file with coordinates for d6pxab1.
(The format of our PDB-style files is described here.)

Timeline for d6pxab1: