SCOPe 2.04: Domain d1bbxd_: 1bbx D:

Lineage for d1bbxd_ (1bbx D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins)

6. Protein DNA-binding protein [54162] (2 species)

7. Species Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (7 PDB entries)
   Uniprot P61991

8. Domain d1bbxd_: 1bbx D: [37466]
   protein/DNA complex

Details for d1bbxd_

PDB Entry: 1bbx

PDB Description: non-specific protein-dna interactions in the sso7d-dna complex, nmr, 1 structure

PDB Compounds: (D:) DNA-binding protein 7d

SCOPe Domain Sequences for d1bbxd_:

Sequence; same for both SEQRES and ATOM records:

>d1bbxd_ b.34.13.1 (D:) DNA-binding protein {Sulfolobus solfataricus, Sso7d [TaxId: 2287]}
atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qkk

Timeline for d1bbxd_:

• d1bbxd_ first appeared (with stable ids) in SCOP 1.55
  
• d1bbxd_ appears in SCOPe 2.03
  
• d1bbxd_ appears in SCOPe 2.05
  
• d1bbxd_ appears in the current release, SCOPe 2.08