Lineage for d1bbxd_ (1bbx D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. Superfamily d.9.2: Chromo domain-like [54160] (2 families) (S)
  5. Family d.9.2.1: "Histone-like" proteins from arhaea [54161] (1 protein)
  6. Protein DNA-binding protein [54162] (2 species)
  7. Species Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (5 PDB entries)
  8. 30201Domain d1bbxd_: 1bbx D: [37466]

Details for d1bbxd_

PDB Entry: 1bbx (more details)

PDB Description: non-specific protein-dna interactions in the sso7d-dna complex, nmr, 1 structure

SCOP Domain Sequences for d1bbxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbxd_ d.9.2.1 (D:) DNA-binding protein {Sulfolobus solfataricus, Sso7d}
atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qkk

SCOP Domain Coordinates for d1bbxd_:

Click to download the PDB-style file with coordinates for d1bbxd_.
(The format of our PDB-style files is described here.)

Timeline for d1bbxd_:

30201
d1bbxd_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1bbxc_