Lineage for d1bbxd_ (1bbx D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785034Family b.34.13.1: Histone-like proteins from archaea [54161] (2 proteins)
  6. 2785035Protein DNA-binding protein [54162] (2 species)
  7. 2785045Species Sulfolobus solfataricus, Sso7d [TaxId:2287] [54163] (8 PDB entries)
    Uniprot P61991
  8. 2785054Domain d1bbxd_: 1bbx D: [37466]
    protein/DNA complex

Details for d1bbxd_

PDB Entry: 1bbx (more details)

PDB Description: non-specific protein-dna interactions in the sso7d-dna complex, nmr, 1 structure
PDB Compounds: (D:) DNA-binding protein 7d

SCOPe Domain Sequences for d1bbxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbxd_ b.34.13.1 (D:) DNA-binding protein {Sulfolobus solfataricus, Sso7d [TaxId: 2287]}
atvkfkykgeekqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
qkk

SCOPe Domain Coordinates for d1bbxd_:

Click to download the PDB-style file with coordinates for d1bbxd_.
(The format of our PDB-style files is described here.)

Timeline for d1bbxd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bbxc_