SCOPe 2.07: Domain d6tz6b_: 6tz6 B:

Lineage for d6tz6b_ (6tz6 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Candida albicans [TaxId:294748] [374552] (1 PDB entry)

8. Domain d6tz6b_: 6tz6 B: [374565]
   Other proteins in same PDB: d6tz6a_, d6tz6c_, d6tz6d_, d6tz6f_
   automated match to d5b8ib_
   complexed with ca, edo, fe, fk5, po4, zn

Details for d6tz6b_

PDB Entry: 6tz6, 2.55 Å

PDB Description: crystal structure of candida albicans calcineurin a, calcineurin b, fkbp12 and fk506 (tacrolimus)

PDB Compounds: (B:) Calcineurin subunit B

SCOPe Domain Sequences for d6tz6b_:

Sequence, based on SEQRES records:

>d6tz6b_ a.39.1.0 (B:) automated matches {Candida albicans [TaxId: 294748]}
ieeidrlrkrfmkldkdgsgqidkqeflsipgissnplatrlmdvfdkdgdgsidfeefi
tglsafsgksdnlnklrfafniydidrdgyigngelfivmkmmvgknlkdeelqqivdkt
lmeadldgdgklnfeefknavntdtiantlt

Sequence, based on observed residues (ATOM records):

>d6tz6b_ a.39.1.0 (B:) automated matches {Candida albicans [TaxId: 294748]}
ieeidrlrkrfmklidkqeflsipgissnplatrlmdvfdkdgdgsidfeefitglsafs
dnlnklrfafniydidrdgyigngelfivmkmmvgknlkdeelqqivdktlmeadldgdg
klnfeefknavntdtiantlt

Timeline for d6tz6b_:

• d6tz6b_ is new in SCOPe 2.07-stable
  
• d6tz6b_ appears in the current release, SCOPe 2.08