Lineage for d5b8ib_ (5b8i B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2324762Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2324763Protein automated matches [190513] (36 species)
    not a true protein
  7. 2324784Species Coccidioides immitis [TaxId:246410] [272847] (1 PDB entry)
  8. 2324785Domain d5b8ib_: 5b8i B: [272848]
    Other proteins in same PDB: d5b8ia_, d5b8ic_
    automated match to d2ehba_
    complexed with ca, edo, fe, fk5, mes, zn

Details for d5b8ib_

PDB Entry: 5b8i (more details), 1.85 Å

PDB Description: crystal structure of calcineurin a and calcineurin b in complex with fkbp12 and fk506 from coccidioides immitis rs
PDB Compounds: (B:) Calcineurin subunit B, variant

SCOPe Domain Sequences for d5b8ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b8ib_ a.39.1.0 (B:) automated matches {Coccidioides immitis [TaxId: 246410]}
mssqvlndivsgsnfdheevdrlwkrfmkldrdksgtierdeflslpqvssnplstrmia
ifdedgggdvdfqefvsglsafsskgnkeeklrfafkvydidrdgfisngelfivlkmmv
gsnlkdmqlqqivdktimeadldgdgrisfeeftrmventdvsmsmtldqf

SCOPe Domain Coordinates for d5b8ib_:

Click to download the PDB-style file with coordinates for d5b8ib_.
(The format of our PDB-style files is described here.)

Timeline for d5b8ib_: