SCOPe 2.07: Domain d6tz6c_: 6tz6 C:

Lineage for d6tz6c_ (6tz6 C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Candida albicans [TaxId:237561] [322564] (6 PDB entries)

8. Domain d6tz6c_: 6tz6 C: [374535]
   Other proteins in same PDB: d6tz6a_, d6tz6b_, d6tz6d_, d6tz6e_
   automated match to d5hw7a_
   complexed with ca, edo, fe, fk5, po4, zn

Details for d6tz6c_

PDB Entry: 6tz6, 2.55 Å

PDB Description: crystal structure of candida albicans calcineurin a, calcineurin b, fkbp12 and fk506 (tacrolimus)

PDB Compounds: (C:) FK506-binding protein 1

SCOPe Domain Sequences for d6tz6c_:

Sequence, based on SEQRES records:

>d6tz6c_ d.26.1.0 (C:) automated matches {Candida albicans [TaxId: 237561]}
elpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikgw
disltnnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn

Sequence, based on observed residues (ATOM records):

>d6tz6c_ d.26.1.0 (C:) automated matches {Candida albicans [TaxId: 237561]}
elpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikgw
disltnnygkggpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn

Timeline for d6tz6c_:

• d6tz6c_ is new in SCOPe 2.07-stable
  
• d6tz6c_ appears in the current release, SCOPe 2.08