Lineage for d6jy3g_ (6jy3 G:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3024907Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 3024908Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 3024909Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 3024910Species Cow (Bos taurus) [TaxId:9913] [81408] (56 PDB entries)
  8. 3024967Domain d6jy3g_: 6jy3 G: [374160]
    Other proteins in same PDB: d6jy3a_, d6jy3b1, d6jy3b2, d6jy3c_, d6jy3d_, d6jy3e_, d6jy3f_, d6jy3h_, d6jy3i_, d6jy3j_, d6jy3k_, d6jy3l_, d6jy3m_
    automated match to d1v54g_
    complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, per, pgv, zn

Details for d6jy3g_

PDB Entry: 6jy3 (more details), 1.85 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully oxidized state
PDB Compounds: (G:) Cytochrome c oxidase subunit 6A2, mitochondrial

SCOPe Domain Sequences for d6jy3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jy3g_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
gartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpfswgdgnhtffh
nprvnplptgye

SCOPe Domain Coordinates for d6jy3g_:

Click to download the PDB-style file with coordinates for d6jy3g_.
(The format of our PDB-style files is described here.)

Timeline for d6jy3g_: