SCOPe 2.08: Domain d6jy3h_: 6jy3 H:

Lineage for d6jy3h_ (6jy3 H:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)

6. Protein Cytochrome c oxidase subunit h [47696] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47697] (33 PDB entries)

8. Domain d6jy3h_: 6jy3 H: [374203]
   Other proteins in same PDB: d6jy3a_, d6jy3b1, d6jy3b2, d6jy3c_, d6jy3d_, d6jy3e_, d6jy3f_, d6jy3g_, d6jy3i_, d6jy3j_, d6jy3k_, d6jy3l_, d6jy3m_
   automated match to d1v54h_
   complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, per, pgv, zn

Details for d6jy3h_

PDB Entry: 6jy3, 1.85 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully oxidized state

PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d6jy3h_:

Sequence; same for both SEQRES and ATOM records:

>d6jy3h_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

Timeline for d6jy3h_:

• d6jy3h_ first appeared in SCOPe 2.07