Lineage for d1ilqb_ (1ilq B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253528Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 253529Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 253530Family d.9.1.1: Interleukin 8-like chemokines [54118] (23 proteins)
  6. 253567Protein Interleukin-8, IL-8 [54119] (1 species)
  7. 253568Species Human (Homo sapiens) [TaxId:9606] [54120] (9 PDB entries)
  8. 253581Domain d1ilqb_: 1ilq B: [37368]
    complexed with ace, hex, nh2; mutant

Details for d1ilqb_

PDB Entry: 1ilq (more details)

PDB Description: cxcr-1 n-terminal peptide bound to interleukin-8 (minimized mean)

SCOP Domain Sequences for d1ilqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ilqb_ d.9.1.1 (B:) Interleukin-8, IL-8 {Human (Homo sapiens)}
akelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrv
vekflkraens

SCOP Domain Coordinates for d1ilqb_:

Click to download the PDB-style file with coordinates for d1ilqb_.
(The format of our PDB-style files is described here.)

Timeline for d1ilqb_:

253581
d1ilqb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1ilqa_