![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (16 species) |
![]() | Species Listeria innocua [TaxId:272626] [373578] (2 PDB entries) |
![]() | Domain d6hvqd_: 6hvq D: [373635] automated match to d1qgha_ complexed with la |
PDB Entry: 6hvq (more details), 1.9 Å
SCOPe Domain Sequences for d6hvqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hvqd_ a.25.1.1 (D:) Dodecameric ferritin homolog {Listeria innocua [TaxId: 272626]} svdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerll aiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegd dvtndmliafkasidkhiwmfkaflgkaple
Timeline for d6hvqd_: