SCOPe 2.07: Domain d6joea1: 6joe A:5-250

Lineage for d6joea1 (6joe A:5-250)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
   fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain

6. Protein automated matches [196235] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208963] [343276] (7 PDB entries)

8. Domain d6joea1: 6joe A:5-250 [373600]
   Other proteins in same PDB: d6joea2, d6joeb2
   automated match to d1p9pa_
   protein/RNA complex; complexed with bwr, po4, sam

Details for d6joea1

PDB Entry: 6joe, 2.21 Å

PDB Description: crystal structure of trmd from pseudomonas aeruginosa in complex with active-site inhibitor

PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d6joea1:

Sequence, based on SEQRES records:

>d6joea1 c.116.1.4 (A:5-250) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
lwvgvvsifpemfraisdygitsravkqglltltcwnprvytedrhqtvddrpfgggpgm
vmkikplegaladarqaaggrkakviylspqgrqltqagvrelaeeealiliagryegid
erfieehvdeewsigdyvlsggelpamvlvdavtrllpgalghadsaeedsftdglldcp
hytrpevyadkrvpevllsgnhehirrwrlqqalgrtwerradlldsrslsgeeqkllae
yirqrd

Sequence, based on observed residues (ATOM records):

>d6joea1 c.116.1.4 (A:5-250) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
lwvgvvsifpemfraisdygitsravkqglltltcwnprvytedrhqtvddrpfgggpgm
vmkikplegaladarqaaggrkakviylspqgrqltqagvrelaeeealiliagryegid
erfieehvdeewsigdyvlsggelpamvlvdavtrllpgaleedsftdglldcphytrpe
vyadkrvpevllsgnhehirrwrlqqalgrtwerradlldsrslsgeeqkllaeyirqrd

Timeline for d6joea1:

• d6joea1 is new in SCOPe 2.07-stable
  
• d6joea1 appears in the current release, SCOPe 2.08