Lineage for d1ubpa_ (1ubp A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016224Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 1016225Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 1016226Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 1016227Protein Urease, gamma-subunit [54113] (3 species)
  7. 1016228Species Bacillus pasteurii [TaxId:1474] [54115] (6 PDB entries)
  8. 1016230Domain d1ubpa_: 1ubp A: [37353]
    Other proteins in same PDB: d1ubpb_, d1ubpc1, d1ubpc2
    complexed with bme, ni

Details for d1ubpa_

PDB Entry: 1ubp (more details), 1.65 Å

PDB Description: crystal structure of urease from bacillus pasteurii inhibited with beta-mercaptoethanol at 1.65 angstroms resolution
PDB Compounds: (A:) urease

SCOPe Domain Sequences for d1ubpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubpa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOPe Domain Coordinates for d1ubpa_:

Click to download the PDB-style file with coordinates for d1ubpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ubpa_: