SCOPe 2.08: Domain d1ubpa_: 1ubp A:

Lineage for d1ubpa_ (1ubp A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
   automatically mapped to Pfam PF00547

6. Protein Urease, gamma-subunit [54113] (4 species)

7. Species Bacillus pasteurii [TaxId:1474] [54115] (9 PDB entries)

8. Domain d1ubpa_: 1ubp A: [37353]
   Other proteins in same PDB: d1ubpb_, d1ubpc1, d1ubpc2
   complexed with bme, ni

Details for d1ubpa_

PDB Entry: 1ubp, 1.65 Å

PDB Description: crystal structure of urease from bacillus pasteurii inhibited with beta-mercaptoethanol at 1.65 angstroms resolution

PDB Compounds: (A:) urease

SCOPe Domain Sequences for d1ubpa_:

Sequence; same for both SEQRES and ATOM records:

>d1ubpa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

Timeline for d1ubpa_:

• d1ubpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ubpa_ appears in SCOPe 2.07