Lineage for d1ubpa_ (1ubp A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) 
Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein) Protein Urease, gamma-subunit [54113] (2 species) Species Bacillus pasteurii [TaxId:1474] [54115] (4 PDB entries) 
Domain d1ubpa_: 1ubp A: [37353]
Other proteins in same PDB: d1ubpb_, d1ubpc1, d1ubpc2
Details for d1ubpa_
PDB Entry: 1ubp (more details), 1.65 Å
PDB Description: crystal structure of urease from bacillus pasteurii inhibited with beta-mercaptoethanol at 1.65 angstroms resolution
SCOP Domain Sequences for d1ubpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubpa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
SCOP Domain Coordinates for d1ubpa_:
Click to download the PDB-style file with coordinates for d1ubpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ubpa_:
- d1ubpa_ appears in SCOP 1.57
- d1ubpa_ appears in the current release, SCOPe 2.08
View in 3D
