Lineage for d1fo7a_ (1fo7 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29966Fold d.6: Prion protein domain [54097] (1 superfamily)
  4. 29967Superfamily d.6.1: Prion protein domain [54098] (1 family) (S)
  5. 29968Family d.6.1.1: Prion protein domain [54099] (1 protein)
  6. 29969Protein Prion protein domain [54100] (4 species)
  7. 29977Species Human (Homo sapiens) [TaxId:9606] [54103] (14 PDB entries)
  8. 29982Domain d1fo7a_: 1fo7 A: [37314]

Details for d1fo7a_

PDB Entry: 1fo7 (more details)

PDB Description: human prion protein mutant e200k fragment 90-231

SCOP Domain Sequences for d1fo7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo7a_ d.6.1.1 (A:) Prion protein domain {Human (Homo sapiens)}
lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvttttkgenftktdvkmmervveqmcitqyeresqayyqrgss

SCOP Domain Coordinates for d1fo7a_:

Click to download the PDB-style file with coordinates for d1fo7a_.
(The format of our PDB-style files is described here.)

Timeline for d1fo7a_: