SCOP 1.55: Domain d1rca__: 1rca -

Lineage for d1rca__ (1rca -)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (93 PDB entries)

8. Domain d1rca__: 1rca - [37247]

Details for d1rca__

PDB Entry: 1rca, 1.9 Å

PDB Description: structure of the crystalline complex of deoxycytidylyl-3',5'-guanosine (3',5'-dcpdg) co-crystalised with ribonuclease at 1.9 angstroms resolution. retrobinding in pancreatic rnasea is independent of mode of inhibitor intromission

SCOP Domain Sequences for d1rca__:

Sequence; same for both SEQRES and ATOM records:

>d1rca__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d1rca__:

• d1rca__ appears in SCOP 1.57
  
• d1rca__ appears in the current release, SCOPe 2.08, called d1rcaa_