Lineage for d6a1ea1 (6a1e A:34-236)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330024Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2330425Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2330752Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 2330753Protein automated matches [226931] (11 species)
    not a true protein
  7. 3067196Species Santalum album [TaxId:35974] [367258] (11 PDB entries)
  8. 3071704Domain d6a1ea1: 6a1e A:34-236 [371766]
    Other proteins in same PDB: d6a1ea2
    automated match to d2onha1
    complexed with co3, fps, gol, so4, trs

Details for d6a1ea1

PDB Entry: 6a1e (more details), 1.89 Å

PDB Description: crystal structure of a synthase 1 from santalum album in complex with ligand fps
PDB Compounds: (A:) Sesquisabinene B synthase 1

SCOPe Domain Sequences for d6a1ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a1ea1 a.102.4.0 (A:34-236) automated matches {Santalum album [TaxId: 35974]}
anlwdydflqslgrhssvteehvglaeklkgevkslitgpmeplaklefidsvrrlglky
qfetemkealaniskdgydswwvdnlratalrfrllrengifvpqdvferfqnketgkfk
nelcedvkgllnlyeasflgwegedildeartfstaqlknvegkisspnlakivhhaldl
plhwrairyearwfidiyedeed

SCOPe Domain Coordinates for d6a1ea1:

Click to download the PDB-style file with coordinates for d6a1ea1.
(The format of our PDB-style files is described here.)

Timeline for d6a1ea1:

  • d6a1ea1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6a1ea2