PDB entry 6a1e

View 6a1e on RCSB PDB site
Description: Crystal structure of a synthase 1 from Santalum album in complex with ligand fps
Class: transferase
Keywords: ligand synthase, TRANSFERASE
Deposited on 2018-06-07, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sesquisabinene B synthase 1
    Species: Santalum album [TaxId:35974]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6a1ea1, d6a1ea2
  • Heterogens: SO4, CO3, FPS, TRS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6a1eA (A:)
    mdlcqipptspispsvpfngddssvvrrsanypanlwdydflqslgrhssvteehvglae
    klkgevkslitgpmeplaklefidsvrrlglkyqfetemkealaniskdgydswwvdnlr
    atalrfrllrengifvpqdvferfqnketgkfknelcedvkgllnlyeasflgwegedil
    deartfstaqlknvegkisspnlakivhhaldlplhwrairyearwfidiyedeedmnpt
    llkyakldfnivqsfhqaeigrlarwwvgtgldklpfarngliqsymyaigmlfephlge
    vremeakvgalittiddvydvygtmeelelftditerwdinrvdqlprnirmplltmfnt
    sndigywalkergfngipytakvwadqlksytkeakwfheghkptleeylenalvsigfp
    nllvtsylltvdnptkekldyvdslplfvrascilcriindlgtspdemergdnlksiqc
    ymnetgasqevarehieglvrmwwkrlnkclfepspftepflsftinvvrgshffyqygd
    gygnaeswtknqgmsvlihpitldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6a1eA (A:)
    anlwdydflqslgrhssvteehvglaeklkgevkslitgpmeplaklefidsvrrlglky
    qfetemkealaniskdgydswwvdnlratalrfrllrengifvpqdvferfqnketgkfk
    nelcedvkgllnlyeasflgwegedildeartfstaqlknvegkisspnlakivhhaldl
    plhwrairyearwfidiyedeedmnptllkyakldfnivqsfhqaeigrlarwwvgtgld
    klpfarngliqsymyaigmlfephlgevremeakvgalittiddvydvygtmeelelftd
    iterwdinrvdqlprnirmplltmfntsndigywalkergfngipytakvwadqlksytk
    eakwfheghkptleeylenalvsigfpnllvtsylltvdnptkekldyvdslplfvrasc
    ilcriindlgtsdnlksiqcymnetgasqevarehieglvrmwwkrlnkclfepspftep
    flsftinvvrgshffyqnaeswtknqgmsvlihpitld